Loading...
HomeMy WebLinkAbout163 Castle Ln - 246701301002Environmental Health Department P.O. Box 179 500 Broadway Eagle, CO 81631-0179 Phone: (970) 328-8730 Fax: (970) 328-7185 Permit Permit No. OWTS-018326-2020 Permit Type: OWTS Permit Work Classification: Major Repair Permit Status: Active Issue Date: 3/10/2020 Expires: 7/8/2020 On-Site Wastewater Treatement System Project Address Parcel Number 163 CASTLE LN, BASALT AREA,246701301002 Owner Information Address Kevin Cowan 300 S Pointe DR STE Apt 2505 Miami, Phone: (305) 494-0078 Cell: Email: kcowan@shutts.com Inspections: For Inspections Call: (970) 328-8755 and call the Design Engineer Engineer Phone Email CBO Septic Consulting, Carla Ostberg (970) 309-0525 carla.osteberg@gmail.com Contractor License Number Phone Email Hagist Excavation, LLC tim@hagistx.com(970) 379-9726OWTSPL-000061-20 20 Permitted Construction / Details: Replacement of the existing tank exactly as design in the CBO Inc design dated February 20, 2020, stamped, signed, and dated February 26, 2020 by Romeo A Baylosis, PE. The replacement tank is sized for the primary treatment of sewage from a three bedroom residence, which will then gravity flow to the existing seepage pit, original permit IS-39. The design report notes the seepage pit to be dry, in working condition, and outside of the 100 foot well setback. The tank specified is a 1,000 gallon two-compartment Valley Precast septic tank, however if site conditions are not favorable for delivery of a concrete tank, the engineer's consultant has approved substitution for a 1,000 Infiltrator poly septic tank. Be sure to install an effluent filter on the outlet tee and bring access to grade. The existing tank is to be abandoned in place in accordance with ECPHA OWTS Regulation 43.9.C. The design engineer is responsible for conducting all inspections necessary to certify the installation and assure functionality of the system. System certification, along with photos and a record drawing is required to be submitted to, and approved by, Eagle County Environmental Health prior to the use of the system. THIS PERIMT EXPIRES BY TIME LIMITATION AND BECOMES NULL AND VOID IF THE WORK AUTHORIZED BY THE PERMIT IS NOT COMMENCED WITHIN 120 DAYS OF ISSUANCE, OR BEFORE THE EXPIRATION OF AN ASSOCIATED BUILDING PERMIT Issued by: Environmental Health Department, Eagle County, CO Claire Lewandowski Date March 10, 2020 CONDITIONS 1. 2.ALL INSTALLATIONS MUST COMPLY WITH ALL REQUIREMENTS OF THE EAGLE COUNTY PUBLIC HEALTH AGENCY ON-SITE WASTEWATER TREATMENT SYSTEM REGULATIONS ADOPTED PURSUANT TO AUTHORITY GRANTED IN CR.S. 25-10-101, et seq., AS AMENDED 3.THIS PERMIT IS VALID ONLY FOR PERFORMING WORK ON OWTS ASSOCIATED WITH STRUCTURES WHICH HAVE FULLY COMPLIED WITH COUNTY ZONING AND BUILDING REQUIREMENTS CONNECTION TO, OR USE WITH, ANY DWELLING OR STRUCTURE NOT APPROVED BY THE ZONING AND BUILDING DEPARTMENTS SHALL AUTOMATICALLY BE A VIOLATION OF A REQUIREMENT OF THE PERMIT AND WILL RESULT IN BOTH LEGAL ACTION AND REVOCATION OF THE PERMIT 4.1.6(A)(1) EAGLE COUNTY PUBLIC HEALTH AGENCY ON-SITE WASTEWATER TREATMENT SYSTEM REGULATIONS REQUIRES ANY PERSON WHO CONSTRUCTS, ALTERS OR INSTALLS AN ON-SITE WASTEWATER TREATMENT SYSTEM TO BE LICENSED Tuesday, March 10, 2020 1 March 25, 2020 Kevin Cowan kcowan@shutts.com RE: Final approval of the: Septic System Installation, OWTS-018326-2020 Property location: 163 Castle Lane, Eagle County Mr. Cowan, This letter is to inform you that the above-referenced permit was inspected and is finalized. This OWTS the tank replacement and final certification from CBO Inc is approved to serve the three (3) bedroom residence. Additional information about the maintenance your septic system needs can be accessed through our website links, provided on the Environmental Health Department’s septic system resource page. Be aware that changes in the use of your property or alterations of your building may require commensurate changes to, or relocation of, your septic system. Landscape features, trees with tap roots, irrigation systems and parking areas above the soil treatment area can cause premature system failure. It is equally important that you notice and immediately repair dripping faucets and hissing toilets as this will certainly cause the system to fail. If you have any questions regarding this information, please contact us at (970) 328 -8755 and reference the OWTS septic permit number. Best Regards, Claire Lewandowski, REHS Environmental Health Specialist III Attachments: Certification Letter and Design – Septic System Flyer – Final Letter PUBLIC HEALTH & ENVIRONMENT (970) 328-8755 FAX: (970) 328-8788 environment@eaglecounty.us 33 Four Wheel Drive Road Carbondale, CO 81623 970.309.5259 carla.ostberg@gmail.com February 20, 2020 Project No. C1500 Kevin Cowan kcowan@shutts.com Onsite Wastewater Treatment System Design (Septic Tank Replacement) 3-Bedroom Residence 163 Castle Lane Eagle County, Colorado Kevin, CBO Inc. has completed an onsite wastewater treatment system (OWTS) design for the subject residence. The 1.21-acre property is located outside of Basalt, in an area where OWTSs and wells are necessary. The legal description of the property is Lot 11, Seven Castles Estates Subdivision. Parcel ID: 2467-013-01-002 SITE CONDITIONS A 3-bedroom single-family residence is currently developed on the property. The residence is served by an existing OWTS. The permit and record drawing were provided by Eagle County Environmental Health Department (Parcel ID # 2467-013-01-002). The subject OWTS consists of one 1250-gallon, three- compartment concrete ‘Jet’ Aeration septic tank. Effluent gravity flows to a drywell, or seepage pit. Eagle County Department of Environmental Health Permit No. 39 documents this system. The system was sized to accommodate 3 bedrooms. The permit was issued on August 11, 1975. It does not appear the permit received final approval. An inspection was conducted by CBO Inc. on November 21, 2019. The septic tank was found to be empty at the time of the inspection and with no reports of recent pumping, we determined the septic tank was leaking. Recommendations resulting from the inspection included the following: • Explore cast iron sewer line from house to septic tank. • Locate drywell/seepage pit to determine location and condition. • Replace septic tank. All recommendations have been completed and are addressed in this design. The residence is served by a well, located south of the residence and looped driveway. This well is located greater than 50-feet from the proposed septic tank. Table 1 describes the minimum required setback of OWTS components to physical features on the property compared to approximate, proposed setback distances. Page 2 Table 1 OWTS Components and Physical Features Minimum Required Setback Approximate Proposed Setback House to Septic Tank 5’ 15’ Septic Tank to Well 50’ 100’ Septic Tank to Water Course n/a n/a DESIGN SPECIFICATIONS The existing septic tank will be abandoned in place. The septic tank must be collapsed and remaining void filled with compacted on-site soils. The existing sewer line from the cleanout in the lower level of the residence (pictured below) is cast iron. We brought the camera in through this access point. There is a slight dip in the line at approximately 25’ from the entry point (holds water) and approximately 31’ 4” from our entry point there is an additional cleanout (does not appear to be accessible from grade) and the line turns to PVC. We located the camera at the point the cast iron transitions to PVC and found it to be approximately 4 to 4.5-feet below grade. Working with existing conditions, our septic tank may be slightly deeper than 4-feet. The new septic tank will be set closer to the residence than the existing septic tank, which is currently located in a berm with landscaping and trees. The existing septic tank has 5-feet or more of risers because of its location in the berm. By moving the septic tank closer to the house and outside of the berm, we are able to minimize the height of the risers required to bring access to grade. Starting point for camera work / located in lower level of house It should be noted that cast iron is prone to deterioration and clogging. While the sewer line appeared to be clear at the time we did our camera work, deterioration and clogging will worsen over time. Consideration should be made to address the cast iron pipe. Replacement may not be feasible due to its location under the slab and decking. Cast in-place pipe lining (CIPP) may be considered. For the purposes of this OWTS design, Benchmark Elevation has been established as 100’ as the existing sewer line, which was located off the south corner of the stairs to the deck approximately 4 to 4.5-feet below grade, as indicated on W1.0 Site Plan. CBO Inc. should be notified of any discrepancies or problems with grade elevations of proposed components during installation of the OWTS. Page 3 OWTS Component Minimum Elevation Primary Tank Inlet Invert 100’ (tank will be installed at location of existing sewer line beyond deck) Inlet to Seepage Pit Existing (greater than 1% fall from proposed septic tank to existing sewer line to the seepage pit) A new, double-sweep cleanout must be installed before the new septic tank. The system installation will include a 1000-gallon, two-compartment concrete septic tank1. Risers must be installed to bring the manhole lids accessible from grade. An effluent filter must be installed on the outlet tee of the septic tank. A handle extension must also be added to the effluent filter. There is an existing effluent filter in the existing septic tank. This filter, housing, and handle extension may be re-used if full size and found to be in good condition. A new, 4-inch diameter SDR 35 sewer line must connect to the existing sewer line that leads to the seepage pit. We ran a camera through this section of sewer line and found it to be in good condition. We were also able to partially view the seepage pit, which appeared to be dry and made of perforated concrete rings. The location of the camera as it entered the septic tank was approximately 21-feet from the existing septic tank outlet and approximately 6-feet below grade at the inlet of the seepage pit. We strongly recommend gaining access to the seepage pit and brining access to grade for future inspection and monitoring. It should be noted that access to the seepage pit with equipment may not be feasible from the subject property. The neighboring property to the south has a driveway that appears to offer a more feasible access. Permission from the neighboring property owner should be obtained for access. Without knowing how the seepage pit is constructed, we are unable to provide component specifications to bring access to grade. COMPONENT SPECIFICATIONS The component manufacturers are typical of applications used by contractors and engineers in this area. CBO Inc. must approve alternative components prior to installation of the OWTS. Requests must be submitted, in writing, to our office for approval prior to installation. Component technical data sheets are available upon request. COMPONENT MANUFACTURER MODEL NO. COMMENTS Septic Tank Valley Precast Item # 1000T-2CP 2-compartment concrete septic tank (OPTION) Septic Tank Infiltrator® IM-1530-2CP 2-compartmetn poly septic tank Tank Risers and Lids Orenco® Double-walled PVC Risers and Lids (24” diameter) Biotube Effluent Filter EXISTING FILTER MAY BE RE-USED Orenco® 4” Biotube Effluent Filter (full size) 1 We are recommending a concrete septic tank. A 1000-gallon, two-compartment Infiltrator® poly septic tank may be considered if road conditions do not allow delivery of a concrete septic tank. Page 4 The component manufacturers are typical of applications used by contractors and engineers in this area. Alternatives may be considered or recommended by contacting our office. Construction must be according to Eagle County On-Site Wastewater Treatment System Regulations, the OWTS Permit provided by Eagle County Environmental Health Department, and this design. INSTALLATION CONTRACTOR CBO Inc. expects that the installer be experienced and qualified to perform the scope of work outlined in this design. The installer must review this design thoroughly and coordinate with our office in advance of installation. Any additional conditions in this design or county permit must be completed and documented prior to final approval of the OWTS installation. Communication between the installer and this office is expected throughout the installation. INSTALLATION OBSERVATIONS CBO Inc. must view the OWTS during construction. The OWTS observation should be performed before backfill, after placement of OWTS components. Septic tanks, distribution devices, pumps, dosing siphons, and other plumbing, as applicable, must also be observed. CBO Inc. should be notified 48 hours in advance to observe the installation. In an effort to improve the accuracy of the record drawing, we request that the installer provide a sketch of the installation, including path of the sewer lines, water line installation (if applicable), septic tank location, STA location, and measurements from building corners or another fixed objects on the property. This sketch is most easily provided on Sheet W2.0 of the OWTS Design Packet. Photographs of the installation and final cover are also requested to supplement our installation documentation. REVEGETATION REQUIREMENTS An adequate layer of good quality topsoil capable of supporting revegetation shall be placed over the entire disturbed area of the OWTS installation. A mixture of native grass seed that has good soil stabilizing characteristics (but without taproots), provides a maximum transpiration rate, and competes well with successional species. No trees or shrubs, or any vegetation requiring regular irrigation shall be placed over the area. Until vegetation is reestablished, erosion and sediment control measures shall be implemented and maintained on site. The owner of the OWTS shall be responsible for maintaining proper vegetation cover. OPERATION INFORMATION AND MAINTENANCE The property owner shall be responsible for the operation and maintenance of each OWTS servicing the property. The property owner is responsible for maintaining service contracts for manufactured units, alternating STAs, and any other components needing maintenance. Geo-fabrics or plastics should not be used over the STA. No heavy equipment, machinery, or materials should be placed on the backfilled STA. Machines with tracks (not wheels) should be used during construction of the STA for better weight distribution. Livestock should not graze on the STA. Plumbing fixtures should be checked to ensure that no additional water is being discharged to OWTS. For example, a running toilet or leaky faucet can discharge hundreds of gallons of water a day and harm a STA. If an effluent filter or screen has been installed in the OWTS, we recommend this filter or screen be cleaned annually, or as needed. If the OWTS consists of a pressurized pump system, we recommend the laterals be flushed annually, or as needed. Page 5 2-26-2020 The homeowner should pump the septic tank every two years, or as needed gauged by measurement of solids in the tank. Garbage disposal use should be minimized, and non-biodegradable materials should not be placed into the OWTS. Grease should not be placed in household drains. Loading from a water softener should not be discharged into the OWTS. No hazardous wastes should be directed into the OWTS. Mechanical room drains should not discharge into the OWTS. The OWTS is engineered for domestic waste only. ADDITIONAL CONSTRUCTION NOTES If design includes a pump, weep holes must be installed to allow pump lines to drain to minimize risk of freezing. The pump shall have an audible and visual alarm notification in the event of excessively high water conditions and shall be connected to a control breaker separate from the high-water alarm breaker and from any other control system circuits. The pump system shall have a switch so the pump can be manually operated. Extensions should be placed on all septic tank components to allow access to them from existing grade. Backfill over the STA must be uniform and granular with no material greater than minus 3-inch. LIMITS: The design is based on information submitted. If soil conditions encountered are different from conditions described in report, CBO Inc. should be notified. All OWTS construction must be according to the county regulations. Requirements not specified in this report must follow applicable county regulations. The contractor should have documented and demonstrated knowledge of the requirements and regulations of the county in which they are working. Licensing of Systems Contractors may be required by county regulation. Please call with questions. Sincerely, CBO Inc. Reviewed By: Carla Ostberg, MPH, REHS Romeo A. Baylosis, PE PART OF LOT 11PER REC. NO. 201403960163 CASTLE LANE2.693 AC.±XXXXXXXXXXXXXXXXXXXXXXXXXWN 89°48'00" E 116.40'S 00°00'00" E 722.54'WELLOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOEOETREEHOUSEOESSSET #5 REBARWITH CAPL.S. 37935FOUND #5REBAR WITHCAP ILLEGIBLEFOUND #5REBAR WITHCAP L.S. 19598SANITARYSEWER LIDSFOUND #5REBARN 42°52'23" W217.92'112.50'N 75°14'12"WN 14°45'48" E 551.98'FOUND US GENERALLAND OFFICE SURVEYMONUMENT POSSIBLYDISTURBEDPOWERPOLEOVERHEADELECTRICFENCEFENCEPRIVATE PROPERTYNO TRESPASSING SIGNOLD DIRTROADOLD DIRTROADDRAINAGEAREAFENCE10.4'5.5'SEE HOUSEDETAILSIDEWALKLANDSCAPEISLANDDRIVEWAYDRIVEWAYDIRT ROADCASTLE LANE40' R.O.W.40'5' DRAINAGEAND UTILITYEASEMENT PERPLAT REC. NO.100573WATER WELL EASEMENTPER BK 252 PG 2820' WIDE INGRESS/EGRESSEASEMENT PER BK 252 PG 2820'5' DRAINAGE ANDUTILITY EASEMENTPER PLAT REC. NO.1005735' DRAINAGEAND UTILITYEASEMENT PERPLAT REC. NO.10057338.95'82.72'155.07'(BASIS OF BEARINGS) 2 5 '25' ACCESS EASEMENTPER BK 243 PG 995 &REC. NO. 201907268 &ENCROACHMENT LICENSEREC. NO. 201804026FENCE10' POWER LINE EASEMENTPER BK 243 PG 99510' WATERLINE EASEMENTPER BK 243 PG 995 & BK 252 PG 30LANDSCAPE ENCROACHMENTPER REC. NO. 201907268 &201804026REC. NO. 809341REC. NO. 201723129LOT 1080' PUBLIC SERVICE ELECTRICEASEMENT PER BK 163 PG 3312.5'12.5'25'FENCE12.5'BUILDING SETBACKPER EAGLE COUNTYBUILDING SETBACKPER EAGLE COUNTYBUILDING SETBACKPER EAGLE COUNTY17.9'12.0'9.0'8.0'8.9'9.0' 5 . 2 '5.2'8.4'14.1'18.5'8.1'8.9'17.3'1.5'1.2'0.3'WOOD DECKHOTTUBSTEPWOODDECKWOODDECKFENCESIDEWALKDRIVEWAYNOTICE: ACCORDING TO COLORADO LAW, YOU MUST COMMENCE ANY LEGAL ACTIONBASED UPON ANY DEFECT IN THIS SURVEY WITHIN THREE YEARS AFTER YOU FIRSTDISCOVER SUCH DEFECT. IN NO EVENT MAY ANY ACTION BASED UPON ANY DEFECT INTHIS SURVEY BE COMMENCED MORE THAN TEN YEARS FROM THE DATE OF THECERTIFICATION SHOWN HEREON.ByNO.DateProject NO.RevisionDrawn By:Checked By:Date:Computer File:P.O. Box 1746Rifle, CO 81650Phone (970) 625-1954Fax (970) 579-7150www.peaksurveyinginc.comSNWEPeak Surveying, Inc.Since 2007200041 OF 1KEVIN D. COWANEAGLE COUNTY, COLORADOIMPROVEMENT SURVEY PLATPART OF LOT 11, SEVEN CASTLES EST.163 CASTLE LANEJGJRNJANUARY 30, 2020004.DWGIMPROVEMENT SURVEY PLATPART OF LOT 11, SEVEN CASTLES ESTATES SUBDIVISION NO. 1 ACCORDING TO THE FINAL PLAT RECORDED DECEMBER 9, 1964, RECEPTION NO. 100573COUNTY OF EAGLE, STATE OF COLORADOPROPERTY DESCRIPTIONTHAT PART OF LOT 11 OF THE SEVEN CASTLES ESTATES SUBDIVISION NO. 1, ACCORDING TOTHE PLAT THEREOF FILED DECEMBER 9, 1964 AT RECEPTION NO. 100573, COUNTY OF EAGLE,STATE OF COLORADO, SITUATED IN TRACT NO. 40 OF SECTION 1, TOWNSHIP 8 SOUTH, RANGE86 WEST OF THE 6TH PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS:​BEGINNING AT THE NORTHEAST CORNER OF SAID LOT 11, SAID POINT BEING ANGLE POINTNUMBER 1 OF SAID TRACT 40;​ THENCE DUE SOUTH ALONG THE EAST LINE OF LOT 11 722.54FEET TO A POINT ON THE NORTHERLY R/W LINE OF CASTLE LANE;​ THENCE NORTH 42° 52'23"WEST 217.99 FEET;​ THENCE NORTH 75° 14'12" WEST 112.46 FEET TO A POINT ON THE WESTERLYLINE OF LOT 11;​ THENCE NORTH 14° 45'48" EAST ALONG SAID WESTERLY LINE 551.98 FEET TOA POINT ON THE NORTHERLY LINE OF SAID LOT 11;​ THENCE NORTH 89° 48'00" EAST ALONGSAID NORTHERLY LINE 116.40 FEET TO THE POINT OF BEGINNING.​COUNTY OF EAGLE​STATE OF COLORADO.NESW0306090120150180210240270300330P e a k S urveying, Inc.0505010020025HOUSE DETAILSCALE: 1" = 20'IMPROVEMENT SURVEY STATEMENTI, JASON R. NEIL, HEREBY CERTIFY TO TESSA MINI, KEVIN D. COWAN AND TO LAND TITLEGUARANTEE COMPANY, THAT I AM A PROFESSIONAL LAND SURVEYOR LICENSED UNDER THELAWS OF THE STATE OF COLORADO; THAT THIS IMPROVEMENT SURVEY PLAT IS TRUE,CORRECT AND COMPLETE BASED ON MY KNOWLEDGE, INFORMATION AND BELIEF AS LAIDOUT AND SHOWN HEREON; THAT THIS IMPROVEMENT SURVEY PLAT IS NOT A GUARANTY ORWARRANTY, EITHER EXPRESSED OR IMPLIED, THAT THIS IMPROVEMENT SURVEY PLAT WASMADE BY ME FROM AN ACCURATE SURVEY OF THE REAL PROPERTY PERFORMED BY ME ORUNDER MY DIRECT SUPERVISION ON JANUARY 24 & 28, 2020; THAT, IN THE PREPARATION OFTHIS IMPROVEMENT SURVEY PLAT, I RELIED UPON THE TITLE COMMITMENT PREPARED BYLAND TITLE GUARANTEE COMPANY, ORDER NO. BAR64002915, DATED EFFECTIVE JANUARY 07,2020; THAT THE LOCATION AND DIMENSIONS OF ALL BUILDINGS, IMPROVEMENTS, EASEMENTS,RIGHTS OF WAY IN EVIDENCE OR KNOWN TO ME AND ENCROACHMENTS BY OR ON THE REALPROPERTY AND MATTERS REFERENCED IN SAID TITLE COMMITMENT CAPABLE OF BEINGSHOWN ARE ACCURATELY SHOWN, AND THAT THIS PLAT IS IN ACCORDANCE OF ANIMPROVEMENT SURVEY PLAT AS SET FORTH IN C.R.S. §38-51-102(9). DATED: JANUARY 30, 2020 BY:___________________________________ JASON R. NEIL, P.L.S. NO. 37935 FOR AND ON BEHALF OF PEAK SURVEYING, INC.NOTES:1) THIS PROPERTY IS SUBJECT TO RESERVATIONS, RESTRICTIONS, COVENANTS, BUILDINGSETBACKS AND EASEMENTS OF RECORD, OR IN PLACE AND EXCEPTIONS TO TITLE SHOWN INTHE TITLE COMMITMENT PREPARED BY LAND GUARANTEE COMPANY, COMMITMENT NO.BAR64002915, DATED EFFECTIVE JANUARY 13, 2020.2) THE DATE OF THIS SURVEY WAS JANUARY 24 & 28, 2020.3) BASIS OF BEARINGS FOR THIS SURVEY IS A BEARING OF N14°45'30"E BETWEEN THE ANGLEPOINT OF THE SOUTHERLY LINE OF LOT 11, A #5 REBAR AND CAP LABELED L.S. # 19598 FOUNDIN PLACE AND THE NORTHEAST CORNER OF LOT 11, AP2 TRACT 39, A US GENERAL LAND OFFICESURVEY MONUMENT FOUND IN PLACE.4) UNITS OF MEASURE FOR ALL DIMENSIONS SHOWN HEREON IS U.S. SURVEY FEET.5) THIS SURVEY IS BASED ON THE SEVEN CASTLES ESTATES SUBDIVISION NO. 1 RECORDEDDECEMBER 9, 1964 RECEPTION NO. 100573 IN THE EAGLE COUNTY CLERK AND RECORDERSOFFICE AND BOUNDARY CORNERS FOUND IN PLACE.6) THERE WAS APPROXIMATELY 12" OF SNOW AND ICE ON THE GROUND AT THE TIME OFSURVEY.7) THIS PROPERTY IS SUBJECT TO TELEPHONE RIGHT-OF-WAY AS DESCRIBED IN BOOK 78 ATPAGE 510 AND BOOK 78 AT PAGE 511.8) THIS PROPERTY IS SUBJECT TO MATTERS DESCRIBED IN BOOK 517 PAGE 92.COL O R ADO LICENSEDPROFESSIONAL LAND S U RVEYO R JAS O N R. NEIL37935 • Has 5-10 times more flow area than other brands, so lasts many times longer between clean- ings, increasing homeowner satisfaction • Installs in min- utes inside new or existing tanks; extendible tee handle for easy removal • Easy to clean by simply hosing off whenever the tank needs pumping • Removes about two-thirds of sus- pended solids, on average, extending drainfield life • Corrosion-proof construction, to ensure long life • Lifetime warranty Residential Biotube® Effluent Filters Applications Our patented* 4-in. (100-mm) Biotube Effluent Filters, Biotube Jr., Biotube Insert Filters, and Biotube Base Inlet Filters are ideal for residential septic tanks and have a lifetime warranty. They prevent large solids from leaving the tank, dramatically improving wastewater quality and extending the life of residential drainfields. Standard Features & Benefits • Alarm available, to signal the need for cleaning • Flow modulating discharge orifices available to limit flow rate leaving tank, mitigat- ing surges and increasing retention time • Custom and commercial sizes available Effluent from the relatively clear zone of the septic tank, between the scum and sludge layers, horizontally enters the Biotube Effluent Filter. Effluent then enters the annular space between the housing and the Biotubes, utilizing the Biotubes’ entire surface for filtering. Particles larger than the Biotube’s mesh are prevented from leaving the tank. Optional Features & Benefits Biotube Filtering Process 8-in. (200-mm) Base Inlet Filter 4-in. (100-mm) Insert Filter 4-in. (100-mm) Biotube Jr. (4-in. Biotube cartridge avail- able separately as Insert Filter) Orenco’s superior effluent filters resist clogging better than all other brands. Our stan- dard, full-sized 4-in. (100-mm) Biotube Effluent Filter provides maximum long-term protection in a complete package, with housing. Our 4-in. (100-mm) Biotube Jr., at half the size of our standard model, has more filtering capacity than the full-sized filters sold by other manufacturers. For tanks with existing outlet tees, the Biotube Insert Filter is ideal. And for low-profile tanks, there’s the Base Inlet Filter. * Covered by patent numbers 5,492,635 and 4,439,323 4-in. (100-mm) Biotube Effluent Filter APS-FT-1 Rev. 3.4 © 11/10 Orenco Systems®, Inc. To Order Call your nearest Orenco Systems®, Inc. distributor. For nearest distribu- tor, call Orenco at 800-348-9843 or go to www.orenco.com and click on “Distributor Locator.” Nomenclatures Riser wall Tank wall Filter housing Extendible PVC handle Stainless steel set screws Top seal plate Air vents Biotube® filter cartridge Solid base 4-in. Biotube Effluent Filter 4-in. Biotube Jr. 4-in. Biotube Filter (standard) 4-in. Biotube Jr. (includes cartridge and housing) Distributed By: 8-in. Biotube Filter (base inlet model) 4-in. Biotube Filter Insert (cartridge only) Junior series FT J0418 Biotube effluent filter series Filter diameter (inches) Cartridge height (inches) W = fits Type 3034 outlet tee S = fits Schedule 40 outlet tee Options: Blank = no options M = flow modulation plate installed A = float bracket attached Blank = 1/8" filtration P = 1/16" filtration Insert FT i0418 Biotube effluent filter series Filter diameter (inches) Cartridge height (inches) W = fits Type 3034 outlet tee S = fits Schedule 40 outlet tee - For customized options (e.g., NC indicates North Carolina regions) - Blank = 1/8" filtration P = 1/16" filtration FT 04 Biotube effluent filter series Filter diameter (inches) Housing height: 36" and 44" are standard Options: Blank = no options M = flow modulation plate installed A = float bracket attached Cartridge height: 28" and 36" are standard - Blank = 1/8" filtration P = 1/16" filtration W = fits Type 3034 outlet pipe S = fits Schedule 40 outlet pipe FT 2208 14 B Biotube effluent filter series Housing height: 22" standard Cartridge height: 14" standard Options: A = float bracket FS = 2" outlet orifice FSO = 2" outlet orifice and overflow plate* Base inlet model - Blank = 1/8" filtration P = 1/16" filtration Filter diameter (inches) 08 = 8" * Also available with coupling and sleeve as a “kit”: FT-OVERFLOWKIT 33 Four Wheel Drive Road Carbondale, CO 81623 970.309.5259 carla.ostberg@gmail.com March 24, 2020 Project No. C1500 Kevin Cowan kcowan@shutts.com Onsite Wastewater Treatment System (OWTS) Installation Observations 163 Castle Lane Eagle County, Colorado Permit Number OWTS-108326-2020 Kevin, CBO Inc. observed the installation of the onsite wastewater treatment system (OWTS), septic tank replacement, on March 24, 2020 for the subject property. Hagist Excavation installed the system. The original OWTS was designed to accommodate a 3-bedroom residence. It should be noted that the existing sewer line from the cleanout in the lower level of the residence (pictured below) is cast iron. We brought the camera in through this access point. There is a slight dip in the line at approximately 25’ from the entry point (holds water) and approximately 31’ 4” from our entry point there is an additional cleanout. This is the point where the new septic tank ties into the existing sewer line. Cast iron is prone to deterioration and clogging. While the sewer line appeared to be clear at the time we did our camera work, deterioration and clogging will worsen over time. Consideration should be made to address the cast iron pipe. Replacement may not be feasible due to its location under the slab and decking. Cast in-place pipe lining (CIPP) may be considered. Starting point for camera work / located in lower level of house 3-24-2020 The existing septic tank was abandoned in place. The septic tank was pumped and collapsed, and the remaining void filled with compacted on-site soils. A new, double-sweep cleanout was installed before the new septic tank, just past the existing deck stairs. The system installation included a 1500-gallon, two-compartment poly Infiltrator® septic tank (specifications enclosed). Approximately 4.5-feet of risers were installed to bring the manhole lids accessible from grade. An effluent filter was installed on the outlet tee of the septic tank. This filter must be cleaned annually, or as needed. Access to the seepage pit was gained and risers installed so it is accessible for future inspection and monitoring. The seepage pit was dry at the time of the septic tank installation, with the depth extending approximately 6.5-feet from the inlet pipe to the bottom of the pit. Water was run from the house into the new septic tank. Photos from the inspection are provided below. Additional photos will be available from the contractor and provided upon request. The OWTS was generally installed according to specifications. This observation is not a guarantee of workmanship and/or parts and materials. CBO Inc. should be notified if changes are made to the OWTS in the future. Any additional OWTS construction must be according to the county regulations. LIMITS: Observations are limited to components that are visible at the time of the inspection. The installer must have documented and demonstrated knowledge of the requirements and regulations of the county in which they are working. The quality of the installation is dependent of the expertise of the installer, soil type, and weather conditions. Please call with questions. Sincerely, CBO Inc. Reviewed By: Carla Ostberg, MPH, REHS Romeo A. Baylosis, PE Septic tank installation new clean out before tank (just beyond deck stairs) Effluent filter (handle extension will be added) / Fernco fitting to adapt cast iron to new sewer line Effluent filter / clean out added after tank view from deck Sewer line will tie into existing pvc pipe Access to seepage pit View looking into seepage pit measuring to bottom of pit Environmental Health Department P.O. Box 179 500 Broadway Eagle, CO 81631-0179 Phone: (970) 328-8730 Fax: (970) 328-7185 Permit Permit No. OWTS-018326-2020 Permit Type: OWTS Permit Work Classification: Major Repair Permit Status: Active Issue Date: 3/10/2020 Expires: 7/8/2020 On-Site Wastewater Treatement System Project Address Parcel Number 163 CASTLE LN, BASALT AREA,246701301002 Owner Information Address Kevin Cowan 300 S Pointe DR STE Apt 2505 Miami, Phone: (305) 494-0078 Cell: Email: kcowan@shutts.com Inspections: For Inspections Call: (970) 328-8755 and call the Design Engineer Engineer Phone Email CBO Septic Consulting, Carla Ostberg (970) 309-0525 carla.osteberg@gmail.com Contractor License Number Phone Email Hagist Excavation, LLC tim@hagistx.com(970) 379-9726OWTSPL-000061-20 20 Permitted Construction / Details: Replacement of the existing tank exactly as design in the CBO Inc design dated February 20, 2020, stamped, signed, and dated February 26, 2020 by Romeo A Baylosis, PE. The replacement tank is sized for the primary treatment of sewage from a three bedroom residence, which will then gravity flow to the existing seepage pit, original permit IS-39. The design report notes the seepage pit to be dry, in working condition, and outside of the 100 foot well setback. The tank specified is a 1,000 gallon two-compartment Valley Precast septic tank, however if site conditions are not favorable for delivery of a concrete tank, the engineer's consultant has approved substitution for a 1,000 Infiltrator poly septic tank. Be sure to install an effluent filter on the outlet tee and bring access to grade. The existing tank is to be abandoned in place in accordance with ECPHA OWTS Regulation 43.9.C. The design engineer is responsible for conducting all inspections necessary to certify the installation and assure functionality of the system. System certification, along with photos and a record drawing is required to be submitted to, and approved by, Eagle County Environmental Health prior to the use of the system. THIS PERIMT EXPIRES BY TIME LIMITATION AND BECOMES NULL AND VOID IF THE WORK AUTHORIZED BY THE PERMIT IS NOT COMMENCED WITHIN 120 DAYS OF ISSUANCE, OR BEFORE THE EXPIRATION OF AN ASSOCIATED BUILDING PERMIT Issued by: Environmental Health Department, Eagle County, CO Claire Lewandowski Date March 10, 2020 CONDITIONS 1. 2.ALL INSTALLATIONS MUST COMPLY WITH ALL REQUIREMENTS OF THE EAGLE COUNTY PUBLIC HEALTH AGENCY ON-SITE WASTEWATER TREATMENT SYSTEM REGULATIONS ADOPTED PURSUANT TO AUTHORITY GRANTED IN CR.S. 25-10-101, et seq., AS AMENDED 3.THIS PERMIT IS VALID ONLY FOR PERFORMING WORK ON OWTS ASSOCIATED WITH STRUCTURES WHICH HAVE FULLY COMPLIED WITH COUNTY ZONING AND BUILDING REQUIREMENTS CONNECTION TO, OR USE WITH, ANY DWELLING OR STRUCTURE NOT APPROVED BY THE ZONING AND BUILDING DEPARTMENTS SHALL AUTOMATICALLY BE A VIOLATION OF A REQUIREMENT OF THE PERMIT AND WILL RESULT IN BOTH LEGAL ACTION AND REVOCATION OF THE PERMIT 4.1.6(A)(1) EAGLE COUNTY PUBLIC HEALTH AGENCY ON-SITE WASTEWATER TREATMENT SYSTEM REGULATIONS REQUIRES ANY PERSON WHO CONSTRUCTS, ALTERS OR INSTALLS AN ON-SITE WASTEWATER TREATMENT SYSTEM TO BE LICENSED Tuesday, March 10, 2020 1 832‐R‐13‐002 33 Four Wheel Drive Road Carbondale, CO 81623 970.309.5259 carla.ostberg@gmail.com November 21, 2019 Danielle Gaines danielle.gaines@compass.com Kevin Cowan kcowan@shutts.com Onsite Wastewater Treatment System (OWTS) Inspection 163 Castle Lane Eagle County, Colorado Danielle, As requested, CBO Inc. performed an Onsite Wastewater Treatment System (OWTS) inspection at 163 Castle Lane, Basalt, Colorado on November 21, 2019. The legal description of the 1.21-acre property is Lot 11, Seven Castles Estates Subdivision. The permit and record drawing were provided by Eagle County Environmental Health Department (Parcel ID # 2467-013-01-002). The subject OWTS consists of one 1250-gallon, three-compartment concrete ‘Jet’ Aeration septic tank. Effluent gravity flows to a drywell. Eagle County Department of Environmental Health Permit No. 39 documents this system. The system was sized to accommodate 3 bedrooms. The permit was issued on August 11, 1975. It does not appear the permit received final approval. An inspection of the system was conducted by D&D Septic Services (now Altitude Septic) on July 1, 2015. The inspection report is enclosed. Additionally, work was done to the system in 2016 including riser installation to bring manhole lids to grade for access, installation of an inlet tee, installation of an effluent filter, and replacement of the ‘Jet’ Aeration component. An email dated July 20, 2016 documents some of this work. We looked in the lower level of the residence and new plumbing ties into an existing cast iron sewer line. Cast iron is prone to clogging and deterioration. We recommend this sewer line be explored to verify the condition of the pipe. The septic tank is located to the west of the residence. All three lids were accessible from grade. We arrived with Altitude Septic with the intent to pump and inspect the septic tank; however, the tank was empty with the exception of some sludge on the bottom of the septic tank. We ran water from the kitchen sink, and it flowed normally into the septic tank. The sludge on the outlet side of the tank appeared to be very dry (see photos below). With no reports of recent pumping, we believe the septic tank is leaking. The septic tank must be replaced. According to a sketch provided with the Eagle County documents, the drywell is located approximately 20-feet from the septic tank on the hillside farther to the west. There appears to be inconsistencies between the sketch with OWTS component locations and the survey and county GIS map. We recommend running a camera through the outlet sewer line to determine the location of the drywell. It is possible that the drywell encroaches on the neighboring property; however, this can only be determined with camera locates and survey stakes locating the property line. We observed the area west of the septic tank in the approximate location of the drywell, which is a relatively steep hillside, and found no evidence of surface saturation or failure at the time of our inspection. There was no access to the drywell, so this component could not be inspected. This evaluation is not a guarantee of future system performance. This inspection is good for one year. Recommendations: • Explore cast iron sewer line from house to septic tank. • Locate drywell to determine location and condition. • Replace septic tank. Disclaimer: This inspection is intended only as an evaluation of the present condition of the OWTS based upon what was observed and the Licensed Inspector’s expertise in onsite wastewater technology. The Inspector has not been retained to warrant or guarantee the proper functioning of the system for any period of time in the future. Because of numerous factors which may affect the operation of an OWTS, as well as the inability of the Inspector to supervise or monitor the use or maintenance of this OWTS, this report shall not be construed as a warranty by the Inspector that the system will function properly for any particular prospective buyer, and the Inspector disclaims any warranty, either expressed or implied, arising from the inspection of the OWTS or this report. The evaluation does not ascertain the impact the system is having on groundwater. Please call with questions. Sincerely, Carla Ostberg, MPH, REHS NAWT Certified Inspector Certification # 11044ITC Exp. April 2020 View of new plumbing into cast iron line Sewer line in lowest level of house drops to existing cast iron line Septic tank lids Inlet (tank empty) middle compartment with aeration device Outlet (note DRY sludge on bottom of tank) Hillside with drywell to west of septic tank 11/22/2019 Eagle County GIS Viewer https://map.eaglecounty.us/GIS_Viewer/?query=Address Labels,PARCEL_NUM,246701301002 1/1 Source: Esri, DigitalGlobe, GeoE + – 0 30 60ft Address, Parcel, or Schedule 39.383 -106.946 Degrees Eagle County GIS Viewer http://www.eaglecounty.us 163 Castle Lane Legend 163 Cas tle Ln 100 ft N➤➤N WE APPRECIATE YOUR BUSINESS! Altitude Septic PO Box 1534 Eagle, CO 81631 US (970) 471-0913 altitudeseptic@gmail.com Invoice 2522 BILL TO Carla Ostberg 163 Castle Lane Basalt, CO 81621 DATE 11/22/2019 PLEASE PAY $150.00 DUE DATE 12/02/2019 DATE ACTIVITY DESCRIPTION QTY RATE AMOUNT 11/21/2019 Service Call We arrived on site to pump the septic tank, but due to it leaking, we were unable to pump it. 1 150.00 150.00 TOTAL DUE $150.00 THANK YOU. 832‐R‐13‐002 EAGLE COUNTY 163 Castle Lane 1 message Claire Lewandowski <claire.lewandowski@eaglecounty.us> Carla Ostberg <carla.ostberg@gmail.com> Mon, Mar 2, 2020 at 4:04 PM To: Claire Lewandowski <claire.lewandowski@eaglecounty.us>, "Kevin D. Cowan" <kcowan@shutts.com>, Timothy Hagist <tim@hagistx.com>, environment@eaglecounty.us Hi Claire, Thanks for taking my call earlier. I spoke with Tim Hagist and the current status of the road is VERY slushy and muddy. So much so that the truck they used to deliver concrete tanks may not be practical this time of year. The owner is wanting to do the work asap, so we may be looking at a poly tank rather than the concrete tank. I would specify an infiltrator tank. They are state approved and most of my installers prefer them. They are easy to install and work well with the full size effluent filter. Attached are some photos of the soils nearby, for your information and Tim's. This would be good backfill for a poly tank. Of course it may vary site to site, but I think it should be consistent. Carla Ostberg CBO Septic Consulting 970.309.5259 Office 981 Cowen Drive, B-7 Carbondale, CO 81623 Mailing 33 Four Wheel Drive Road Carbondale, CO 81623 2 attachments I M G_8971. j pg 192K IMG_8972.jpg 149K EAGLE COUNTY Claire Lewandowski <claire.lewandowski@eaglecounty.us> 163 Castle Lane / Septic Tank Replacement application 6 messages Carla Ostberg <carla.ostberg@gmail.com> Fri, Feb 28, 2020 at 4:20 PM To: environment@eaglecounty.us, Claire Lewandowski <claire.lewandowski@eaglecounty.us>, "Kevin D. Cowan" <kcowan@shutts.com>, Timothy Hagist <tim@hagistx.com> Hi Everyone, Attached is the application and design for the septic tank replacement at 163 Castle Lane. No one is currently living in the house; however, it is under contract for sale which cannot be completed until the new tank is installed. I'm sending a $400 check via mail. It will go out in tomorrow's mail. I have cc'd Kevin Cowan, the property owner, on this email. Thank you and have a great weekend! Carla Ostberg CBO Septic Consulting 970.309.5259 Office 981 Cowen Drive, B-7 Carbondale, CO 81623 Mailing 33 Four Wheel Drive Road Carbondale, CO 81623 3 attachments C1500 Tank Replacement Packet 2 20 20.pdf 4342K �n 163 Castle Lane OWTS Inspection Packet.pdf 7791 K OWTS Permit Application.pdf 351 K Kevin D. Cowan <KCowan@shutts.com> Fri, Feb 28, 2020 at 4:26 PM To: Carla Ostberg <carla.ostberg@gmail.com> Cc: "environment@eaglecounty.us" <environment@eaglecounty.us>, Claire Lewandowski <claire.lewandowski@eaglecounty.us>, Timothy Hagist <tim@hagistx.com> Thank you Sent from my iPhone > On Feb 28, 2020, at 6:20 PM, Carla Ostberg <carla.ostberg@gmail.com> wrote: > EXTERNAL: This email originated from outside of the SHUTTS email system. Do not respond, click any links or open any attachments unless you trust the sender and know the content is safe. [Quoted text hidden] > <C1500 Tank Replacement Packet 2 20 20.pdf> > <163 Castle Lane OWTS Inspection Packet.pdf> > <OWTS Permit Application.pdf> Claire Lewandowski <claire.lewandowski@eaglecounty.us> Thu, Mar 5, 2020 at 3:29 PM To: "Kevin D. Cowan" <KCowan@shutts.com> Cc: Carla Ostberg <carla.ostberg@gmail.com>, "environment@eaglecounty.us" <environment@eaglecounty.us>, Timothy Hagist <tim@hagistx.com> Hi Carla and Kevin, From the report and design, this needs more than the replacement of the septic tank. With repairs of systems that include seepage pits, the seepage pit is only approved to remain in place if a traditional OWTS soil treatment area cannot be accommodated due to space, which must be demonstrated. Further, if the seepage pit must remain in place because of size restrictions, the Public Health Agency must determine if there is a risk to public health or water quality. I would determine that based on review of information provided about setbacks, both vertical and horizontal to all features, especially wells, ground water, water features, and bedrock. That information has not been provided. If the risk is not determined to be low, then the pretreatment in the tank must provide for higher level treatment, and long term operation and maintenance permitting. The information I am providing is form 43.10.1.1,2, & 6, table 7-2 footnote 2. The design must be complete as I cannot permit these items piecemeal. It seems as if there is a STA replacement or an O&M solution the permit fee may be an additional $400 fee as well. Don't hesitate to reach out with questions or concerns. Thank you, Claire [Quoted text hidden] Claire Lewandowski, REHS Environmental Health Specialist III 970-328-8755 (office) 970-328-8747 (direct) environment@eaglecounty.us www.eaglecounty.us �C40 EAGLE COUNTY Public Health & Environment Carla Ostberg <carla.ostberg@gmail.com> Thu, Mar 5, 2020 at 4:52 PM To: Claire Lewandowski <claire.lewandowski@eaglecounty.us> Cc: "Kevin D. Cowan" <KCowan@shutts.com>, "environment@eaglecounty.us" <environment@eaglecounty.us>, Timothy Hagist <tim@hagistx.com> Hi Claire, I would agree that if the seepage pit were new or being repaired, or if the use were being expanded (addition of bedrooms), that the section in the regulations regarding to seepage pits would apply. The only component we are addressing here is the septic tank. The system was previously permitted by Eagle County and nothing aside from the septic tank is in disrepair, which is why I don't think that the section under 43.10.I applies. If this is Eagle County's interpretation, would that mean that with all septic tank replacements, the STAs would need to meet current code requirements? I'm just trying to put this into perspective, as sizing and designs over the years vary with whatever then -current regulatory requirements applied... Let me know your thoughts as I'd like to discuss this further. I left you a phone message, as well. If I miss you tonight, let's catch up tomorrow. Thank you! Carla Ostberg CBO Septic Consulting 970.309.5259 Office 981 Cowen Drive, B-7 Carbondale, CO 81623 Mailing 33 Four Wheel Drive Road Carbondale, CO 81623 [Quoted text hidden] Claire Lewandowski <claire.lewandowski@eaglecounty.us> To: Carla Ostberg <carla.ostberg@gmail.com> Fri, Mar 6, 2020 at 4:58 PM Cc: "Kevin D. Cowan" <KCowan@shutts.com>, "environment@eaglecounty.us" <environment@eaglecounty.us>, Timothy Hagist <tim@hagistx.com> Hi Carla, With any repair we request a statement of functionality, because we cannot repair half a functioning system, whether it is replacing a tank or the field we want to know that it is supportive or public safety and water quality on the other end, and frequently with progressive failure of age the case is that with one failing the other part does too, or it's not far off. With a seepage pit, what is a functioning seepage pit, since it is essentially a hole where partially treated effluent is dumped? Out of sight out of mind? The only way we can presume that it is functioning, not going to affect the safety of the well or groundwater through contamination, is that it meets the horizontal and vertical setbacks for safety, so that is why we need that information, to make that determination. hope this helps [Quoted text hidden] Carla Ostberg <carla.ostberg@gmail.com> Sat, Mar 7, 2020 at 1:45 PM To: Claire Lewandowski<claire.lewandowski@eaglecounty.us>, Romeo Baylosis <romeo@rbcivil.com> Cc: "Kevin D. Cowan" <KCowan@shutts.com>, "environment@eaglecounty.us" <environment@eaglecounty.us>, Timothy Hagist <tim@hagistx.com> Hi Claire, In this case, we were successful in identifying the location AND condition of the seepage pit. That's often not possible, so I was pleased when we were successful in obtaining that information to provide with the design letter. Currently, the seepage pit is dry. My letter states "We were also able to partially view the seepage pit, which appeared to be dry and made of perforated concrete rings. The location of the camera as it entered the septic tank was approximately 21-feet from the existing septic tank outlet and approximately 6-feet below grade at the inlet of the seepage pit. " Measuring from my scaled drawing, the existing seepage pit is 133.5' from the well on the property. Both the 50-foot and 100-foot setbacks were provided in my drawings. The property sits substantially higher than the river. If I had to venture a guess, it is at least 30-feet+ higher elevation than the river. I did soil evaluations on a nearby property to the east recently and soils were very good (Sandy Loam) with no groundwater. Please give me a call on Monday to discuss this further. I'm sorry I missed you Friday afternoon and hope you have a good weekend! Carla Ostberg CBO Septic Consulting 970.309.5259 Office 981 Cowen Drive, B-7 Carbondale, CO 81623 Mailing 33 Four Wheel Drive Road Carbondale, CO 81623 [Quoted text hidden] '�. �b �.�y4 Yr e �9.I T. i.. .,?^c: 4 y �{„ QNY�j�av � ?� � � A SY -; f � 4a' T )� � M' �� ni .K�� 1 �( �� �� L EAGI '1'"-"':INTY DEPARTMENT OF ENV IROC1 AL HEALTH Box 81 I 6th & Broadway Eagle, Colorado 81631 PERMIT NO 39 (this does not constitute • a building or use permit) Owner John Morris System Location Lot 11 - Seven Castles Subdivision Licensed Contractor Self * Conditional Construction approval is hereby granted fora 1000 gallon x Septic Tank or Aerated treatment unit. NOTE: Post on property. Call for final Absorption area (or dispersal area) computed as follows: inspection. Perc rate 1 inches in 12. 5 minutes 600 sq. ft. absorption area per bedroom _200 sa . f t . # of bedrooms 3 x 200 sq. ft. minimum requirement May we suggest a minimum of 600 sq. ft. of leacb field. Date Autiust 11, 1975� a, 'V r� Inspector Erik W. Edeen, R.P.S. FINAL APPROVAL OF SYSTEM: No system shall be deemed to be in compliance with the Sewage Disposal Laws until the assembled system is approved prior to covering any part. Date Septic Tank cleanout to within 12" of final grade or aerated access ports above grade. Proper materials and assembly. Adequate absorption (or dispersal) area. Adequate compliance with permit requirements. Adequate compliance with County and State regulations/requirements. Inspector RETAIN WITH RECEIPT RECORDS AT CONSTRUCTION SITE *CONDITIONS: 1. All .installation must comply with all requirements of the County Individual Sewage Disposal Regulations, adopted pursuant to authority granted in 25-10-104, CRS 1973 amended 25-1-614, CRS 1973 2. This permit is valid only for connection to structures which have fully complied with County Zoning and building requirements. Connection to or use with any dwelling or structures not approved by the building and Zoning office shall automatically be a violation of a requirement of the permit and cause for both legal action and revocation of the permit. 3. Section III, 3.24 requires any person who constructs, alters, or installs an individual sewage disposal system in a manner which involves a knowing and material variation from the terms or specifications con- tained in the application of permit commits a Class I, Petty Offense ($500.00 fine - 6 months in jail or both. ENVIRONMENTAL HEALT► P.O. BOX 811 PERMIT NO. EAGLE, COLORADO 81631 PERMIT FEE $25.00 APPLICATION FOR INDIVIDUAL SEWAGE DISPOSAL SYSTEM PERMIT £, Name of Owner: L�Q�`E P ' A,0R„ Phone: CrZ� -Z O C- Address of Owner: ("' X Is facility within boundaries of a city/town or sanitation district? Distance to nearest sewer system: vv�I lP5 Location of Proposed System: J� u �� `� ( i [. 5 =� v __ D I Q r, 1 ' �z �- �J Legal Discription: `� �� (e tJ ; 1-; :1 i e , 10 1- 6 \ v Type of Structure:. Single Family Dwelling O other: No. Bedrooms Water Supply: Private Well (X ) Location: Distance From leach field: Size of Lot: Public Water Supply: An appropriate plat plan must accompany site inspection for this application showing required information. (See attached sheet.) The individual sewage disposal system will be constructed and instaPledM, in accordance with the regulations governing individual sewage systems within Eagle County, and shall.comply with House Bill 1553 CRS 66-14, 1973. Payment shall be made to the Eagle County Treasurer. Permit, upon approval of this application, may be obtained at the Eagle County sanitarian's office. Appointment for final inspection must be made prior to construction by contacting the inspecting sanitarian. [Phone 328-7718 between 8:30 and 9:00 AM.] Refer to permit number. No approval will be given on any system without final inspection. _Name, address, and telephone of person responsible for design of system: The undersigned acknowledges-fhattithe above information is true and that false information will invalidate the application or subsequent permit. ;f SIGNATURE OF APPLICANT: Date: / (This application becoVy/es invaI 6 months from above date.) HEALTH DEPARTMENT USE ONLY Percolation Information: r ;-- ```- - - Tank Capacity:' gal. (minimum). Absorption Area: `i ?i`1 �` : r , Sq. ft. (minimum) REMARKS: !� Permit No Fee Receipt: File: APPLICATION IS: APPROVED (I DENIED (f ) r _ The above individual sewage disposal system was installed by 4 AND HAS BEEN INSPECTED AND APPROVED BY A REPRESENTATIVE OF THE EAGLE COUNTY HEALTH DEPT. Date: Sanitarian: Royalty Water Service - P. O. BOX 446 BASALT, COLO. 81621 \(6,40 Zo D Je7' A PLA rc- DAV wC-U- IOC° AIL Jc � Hn0s- 7:5 . Ln rJ t` ctF J fZo tM w��L_ Z) i�ZY tr�ec.i.. SOS � $6-=VC-- iJ CSiLeS 5I.,-B -- Diu -AL I NE Ordered by Whom: Melanie Rossow Date: Time Scheduled: 7 / 1 2015: 3 Odin Send Copy to: Fax to: (_) Site Address: 163 Castle Lane Billing Address: Basalt, CO Phone: Phone: A. General nfor atiOn: (Obtain as much as possible when inspection ordered) 1.) Age of wastewater treatment system: 38 years. Was a Homeowner Questionnaire completed? 2.) Number of people occupying dwelling: Currently: 2 If currently unoccupied, for how long has it been vacant?_ 3.) Number of bedrooms in dwelling: 3 Flow meter: 4.) Has there ever been a backup in the house? 5.) List any known repairs made to the system: 6.) Has the system recently been inspected by others? If so, who? did it fail? 7.) Is there a service contract for system components? Co.: 1)9,b -SOe1��c se,rvi;Ce--..ALL 8.) Date the treatment tank last pumped: 2004 At what frequency? Co.: O Yes 18 No Anticipated: months O Yes No O Yes No O Yes 0 No O Yes O No ® Yes O No O Never to my knowledge 9.) The above information is true to the best of my knowledge. Date: Additional Comments: .. , National Association of Wastewater Inc. B. System Type 1.) Components of Wastewater Treatment System — complete as necessary Pretreatment Unit 1: 1250 [ ] a on or gpd] Pump: Pump tank 1: / gpm/ tdh [ ] [ gallons] Pretreatment Unit 2: [ ] [gallons or gpd] 2.) Pump: Pump tank 2: / gpm/ tdh [ ] [gallons] Soil Treatment Unit: [ ] [square feet] Additional Components: 3.) Gray -water run-off or drainage system? O None OSurface OSubsurface Discharge Comments: C. Evaluation Procedures: Check the appropriate boxes. Locate, access, and open the septic tank cover. Yes O No If at grade, is the cover "secure?" OYes O No Can surface water infiltrate into the tank? OYes 0 No Any indicators of previous failure? OYes No Inspect lid, inspect level, measure sludge and scum, check effluent screen. Yes O No Run an operation test ®Yes O No Gallons added in the test: —gal Ions If applicable, pump out primary treatment tank, eYes O No Listen and observe for backflow into the tank from the outlet pipe. Comments: No back flow. Caution: Do not pump treatment tank if there is evidence of a malfunction in any portion Q f the system. Inspect the condition of the primary treatment tank OYes O No (for cracks, infiltration, deterioration, or damage) and the integrity of the inlet and outlet baffles (for deterioration or damage) Yes O No NEVER enter a tank unless proper confined space entry procedures are followed! Does the system contain a dosing or pump tank, ejector or grinder pump? OYes 0 No If so, Did you check integrity of the tank (cracks, infiltration, etc.)? OYes O No Is the pump elevated off the bottom of the chamber? OYes O No Does the pump work? OYes O No If there is a check valve, is a purge hole present? Oyes O No Wastewater Treatment System Inspection Report Is there a high water alarm? OYes O No Does the alarm work? OYes O No Do electrical connections appear satisfactory? Oyes O No Did you clean the pump tank? OYes O No Probe the soil treatment area to determine its location • Yes O No and to check for excessive moisture, odor, and/ or effluent. Type of distribution: Gravity OPressure Is There: Any indication of a previous failure? O Yes No Seepage visible on the lawn? O Yes No Lush vegetation present? O Yes 40 No Ponding water in the Distribution media? O Yes O No Even distribution of effluent in the field? O Yes O No Determine approximate distance between water well and soil treatment area. Approximate distance is 120 feet. Explain answers as necessary: . Sketch of System For reproducible results, show dimensions from structures that will not change, such as corners or the house. Show details, such as the road, in relation to the house to get the correct orientation. Show all located components. Steep 20' Drywell Berm House por 35' • National Association of Wastewater Inc. OWaterwell E. Checklist Summary I.) Pretreatment Unit I is in • Acceptable O Unacceptable condition. Pretreatment Unit 2 is in O Acceptable O Unacceptable condition. Comments: 2.) Soil Treatment area is in ® Acceptable O Unacceptable condition. Comments: 3.) Pump and pump tank is in O Acceptable O Unacceptable condition. Comments: F. Company Disclaimer Based on what we were able to observe and our experience with onsite wastewater technology, we submit this Onsite Wastewater Treatment System Inspection Report based on the present condition of the onsite wastewater treatment system. D&D Septic Services, LLC has not been retained to warrant, guarantee, or certify the proper functioning of the system for any period of time in the future. Because of the numerous factors (usage, soil characteristics, previous failures, etc.) which may effect the proper operation of a wastewater treatment system, this report shall not be construed as a warranty by our company that the system will function properly for any particular buyer._ DISCLAIMS ANY WARRANTY, either expressed or implied, arising from the inspection of the wastewater treatment system or this report. We are also not ascertaining the impact the system is having on the environment. Inspecting Company D&D Septic Services, LLC Phone:( 97p_—) 328-0174 PO Box 3681 Eagle, CO 81631 Wastewater Treatment System Inspection Report F / = 1. (a)Within 10 feet of perimeter of ATU unit, were odors present: (b) If `Yes', rank strength of odor (0= none, 5= strong) 1 2 3 4 5 Color of the active bacteria None Chocolate Black 2. Was foaming/ residue observed outside the unit: OYes ONo 3. Air Supply working satisfactory: OYes ()No 4. Settling chamber appearance satisfactory: ()Yes ONo a. Effluent clarity ( 1 clear ----- 5 cloudy) 1 2 3 4 5 b. DO in the settling chamber ppm c. Settle ability rate % in minutes d. Plugging of media (%) 10% 30 50 75 100% 5. Operation controls working satisfactory: OYes ONo 6. Additional Manufacturer's required maintenance was performed: OYes ()No (If `Yes', attach Manufacturer Inspection form to this report, if supplied) COMMENTS: Media filter 1. Type of Media: sand, peat, synthetic, wetland: 2. Depth of media: 3. Media replacement Oyes ONo 4. Effluent surfacing on top of filter: OYes ONo 5. Ponding in Distribution media: OYes ()No 6. Transparency of effluent after passing through Media filter (check one): (a) Clear (1) to Transparency Milky (5) 1 2 3 4 5 (b) DO in the filter effluent ppm 7. Operation controls working satisfactory: OYes ONo 8. Recirculating Media Filter (a) Was the recirculation equipment operating OYes ONo (b) DO in the recirculation tank: ppm COMMENTS: N/A A National Association of Wastewater Inc. !F-44- � Disinfection System 1. If power is supplied to the unit, was it turned `ON': Oyes ONo 2. Is the disinfection chamber operating properly OYes ONo 3. Chlorination system operating properly OYes ONo Type: Free chlorine value: ppm Testing method : Dechlorination requirements Oyes ONo Type: Ultraviolet [UV] system operating properly OYes ONo Type: UV Bulb operating properly OYes ONo Brightness reading: Required: _Measured: Ozination operating properly OYes ONo Type: _ Source available Oyes ONo Delivery system operating OYes ONo COMMENTS: N/A Drip distribution 1. Manufacturer: Number of zones: 2. Drip System Flushed: Type of emitters: O PC O Non -PC Method: Manual Automatic 3. Drip Filter type: Disk Screen 4. Air release valve operating properly 5. Zone appearance Uniform vegetative growth Vegetative maintenance Settling Proper drainage Wet areas COMMENTS: N/A Wastewater Treatment System Inspection Report OYes ONo Cleaned: OYes ONo OYes ONo OYes ONo OYes ONo OYes ONo OYes ONo OYes ONo 0039—Lot .11'Seven Castles Subd"vsn `Mo'rris " JOB NA Scam �� , =�e G� File JOB NO. e-'-JOB LOCATION BILL TO DATE STARTED COMPLETED CMeT- f key om cr 3 CAI PERMIT # 39 OWNER: John Morris LOCATION: Lot 11 - Seven Castles Subdivision (one acre) INSTALLER: Owner SIZE OF TANK: 1,000 gallons DWELLING: Single Family - 3 bedrooms x 200 sq.ft. = 600 sq.ft. PERC RATE: one inch/12.5 minutes (600 sq.ft.) (suggest a minimum of 600 sq. ft. of leach field) Finalized: (not listed) Application: 8-11-75 DATE BILLED 3 _ �'eqe3 NET PROFIT JOB FOLDER Product 277 ne p NEW ENGLAND BUSINESS SERVICE, INC., GROTON, MASS. 01471 JOB FOLDER Printed In U.S.A.